PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0941s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 396aa    MW: 44826.9 Da    PI: 6.448
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0941s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.61.8e-51161441128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPt+eel+++yL+kkv+++k++l +vi+evd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wk
  SapurV1A.0941s0070.1.p  16 VPPGFRFHPTEEELLHYYLRKKVANEKIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWK 101
                             69****************************.9***************964444222455**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             atg+dk ++s + + +gl+ktLvfy+grap+g+k+dW+mheyrl
  SapurV1A.0941s0070.1.p 102 ATGRDKIIYS-GFKRIGLRKTLVFYRGRAPHGQKSDWIMHEYRL 144
                             **********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-5810174IPR003441NAC domain
PROSITE profilePS5100556.79416174IPR003441NAC domain
PfamPF023652.8E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MPEDMMNLSI NGQSQVPPGF RFHPTEEELL HYYLRKKVAN EKIDLDVIRE VDLNKLEPWD  60
IQEKCKIGST PQNDWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKIIY SGFKRIGLRK  120
TLVFYRGRAP HGQKSDWIMH EYRLDDNTHD TNVSNPIGEG IPEEGWVVCR VFRKKNYQKT  180
LESPKSSSSS LDSKAHQILG SGNDGVLDQI LLYMGRTCKM ENETFSNMNI SNNNSSLRFL  240
SSNNSISEGL HERFMHLPRL DSPPLPSIPM SSPSFDQDRS FKSCYQQSYD EMLTENEPSS  300
SNQIGNCAFE MISSSVIHDS KSGQLNDWVT LDRLVASQLN GQESETSKHL SCFSTDPENI  360
QANTSHVYAN ENDLWGFAKS PSPSSSSDPL CHLSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-481617615170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2158480.0HQ215848.1 Populus trichocarpa wood-associated NAC domain transcription factor 1B (WND1B) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300500.10.0hypothetical protein POPTR_0001s45250g
SwissprotQ9LPI71e-115NAC12_ARATH; NAC domain-containing protein 12
TrEMBLB9GIS70.0B9GIS7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s45250.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.17e-99NAC family protein